PDB entry 1z1r

View 1z1r on RCSB PDB site
Description: HIV-1 protease complexed with Macrocyclic peptidomimetic inhibitor 2
Class: hydrolase
Keywords: macrocyclic inhibitors, peptidomimetic inhibitors, HIV1 protease, hydrolase
Deposited on 2005-03-06, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369
      • engineered (6)
      • engineered (32)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1z1ra1
  • Chain 'B':
    Compound: Pol polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1z1rb1
  • Heterogens: SO4, HBH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1rA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1rB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf