PDB entry 1z1n

View 1z1n on RCSB PDB site
Description: Crystal Structure of the sixteen heme cytochrome from Desulfovibrio gigas
Class: electron transport
Keywords: electron transport
Deposited on 2005-03-04, released 2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: sixteen heme cytochrome
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z1nx_
  • Heterogens: ZN, HEC, GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1z1nX (X:)
    mtqrkraarwvgipcailfltvpfisatastpgpastaepkvdaividtaavfgkleqpg
    vvfyhekhttalekmakdctschvetegklsfkfartvdptsknamaeqyhancmachek
    vvgsyptapqaaeckrchvgpgvegatvtpkpsldlnlhgrhvvaeakrlqvkedescka
    chhtydeaqkklvyakgeegscvychkqeplpspvqqdrvvpstrdashescvnchlstr
    kaqtesgpvlcvgchtaeaqaawkktaetprlfrgqpdatllvagaatangtvdvnwaaa
    gpgpvafdhkahegfvgncvtchhptqtggslaacgvachtttgskdgnfvttaqsahql
    gvttscvgchttqanarkecagchapmqktalsqnsciqcheagfptsgtqtlgkeerea
    taakilaakdekpktvplenvpekltlnymdekgdewqaaefphrkiyqklveeaakspm
    anhfhgdaltmcsgchhnakpslnppkcaschskpfqertanqpglkgafhnqcigchqe
    mqvnpkatdcqgchkpknsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1nX (X:)
    pkvdaividtaavfgkleqpgvvfyhekhttalekmakdctschvetegklsfkfartvd
    ptsknamaeqyhancmachekvvgsyptapqaaeckrchvgpgvegatvtpkpsldlnlh
    grhvvaeakrlqvkedesckachhtydeaqkklvyakgeegscvychkqeplpspvdrvv
    pstrdashescvnchlstrkaqtesgpvlcvgchtaeaqaawkktaetprlfrgqpdatl
    lvagaatangtvdvnwaaagpgpvafdhkahegfvgncvtchhptqtggslaacgvacht
    ttgskdgnfvttaqsahqlgvttscvgchttqanarkecagchapmqktalsqnsciqch
    eagfptsgtqtlgkeereataakilaakdekpktvplenvpekltlnymkgdewqaaefp
    hrkiyqklveeaakspmanhfhgdaltmcsgchhnakpslnppkcaschskpfqertanq
    pglkgafhnqcigchqemqvnpkatdcqgchkpkns