PDB entry 1z1m

View 1z1m on RCSB PDB site
Description: NMR structure of unliganded MDM2
Class: ligase
Keywords: peptide-binding groove, psudosymmetry, alpha-beta domains, LIGASE
Deposited on 2005-03-04, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-117)
      • cloning artifact (118)
    Domains in SCOPe 2.07: d1z1ma1, d1z1ma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1mA (A:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdss