PDB entry 1z1j

View 1z1j on RCSB PDB site
Description: Crystal structure of SARS 3CLpro C145A mutant
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-03-04, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641
      • engineered (144)
    Domains in SCOPe 2.07: d1z1ja_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (0-305)
      • engineered (144)
    Domains in SCOPe 2.07: d1z1jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1jA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngsagsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1jB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngsagsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq