PDB entry 1z1g

View 1z1g on RCSB PDB site
Description: Crystal structure of a lambda integrase tetramer bound to a Holliday junction
Class: DNA binding protein/DNA
Keywords: Protein-DNA complex
Deposited on 2005-03-03, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4.4 Å
R-factor: 0.247
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Bacteriophage lambda
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • modified residue (100)
      • modified residue (126)
      • modified residue (202)
      • modified residue (218)
      • modified residue (254)
      • modified residue (289)
      • modified residue (337)
      • engineered (341)
    Domains in SCOP 1.73: d1z1ga1, d1z1ga2
  • Chain 'B':
    Compound: integrase
    Species: Bacteriophage lambda
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • modified residue (100)
      • modified residue (126)
      • modified residue (202)
      • modified residue (218)
      • modified residue (254)
      • modified residue (289)
    Domains in SCOP 1.73: d1z1gb1, d1z1gb2
  • Chain 'C':
    Compound: integrase
    Species: Bacteriophage lambda
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • modified residue (100)
      • modified residue (126)
      • modified residue (202)
      • modified residue (218)
      • modified residue (254)
      • modified residue (289)
      • modified residue (337)
      • engineered (341)
    Domains in SCOP 1.73: d1z1gc1, d1z1gc2
  • Chain 'D':
    Compound: integrase
    Species: Bacteriophage lambda
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • modified residue (100)
      • modified residue (126)
      • modified residue (202)
      • modified residue (218)
      • modified residue (254)
      • modified residue (289)
    Domains in SCOP 1.73: d1z1gd1, d1z1gd2
  • Chain 'E':
    Compound: 5'-d(*ap*cp*ap*gp*gp*tp*cp*ap*cp*tp*ap*tp*cp*ap*gp*tp*cp*ap*ap*ap*ap*tp*ap*cp*c)-3'
  • Chain 'F':
    Compound: 25-mer
  • Chain 'G':
    Compound: 5'-d(*ap*cp*ap*gp*gp*tp*cp*ap*cp*tp*ap*tp*cp*ap*gp*tp*cp*ap*ap*ap*ap*tp*ap*cp*c)-3'
  • Chain 'H':
    Compound: 25-mer
  • Chain 'I':
    Compound: 29-mer
  • Chain 'J':
    Compound: 29-mer
  • Chain 'K':
    Compound: 29-mer
  • Chain 'L':
    Compound: 29-mer

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1gA (A:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1gA (A:)
    errdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkpltar
    insdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaam
    lngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylk
    iyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalh
    idalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptf
    helrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z1gB (B:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1gB (B:)
    rdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkpltarin
    sdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamln
    gyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiy
    qaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhid
    algismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhe
    lrslsarlyekqisdkfaqhllghksdtewdkieik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z1gC (C:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1gC (C:)
    errdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkpltar
    insdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaam
    lngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylk
    iyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalh
    idalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptf
    helrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z1gD (D:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1gD (D:)
    rdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkpltarin
    sdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamln
    gyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiy
    qaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhid
    algismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhe
    lrslsarlyekqisdkfaqhllghksdtewdkieik
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.