PDB entry 1z1d

View 1z1d on RCSB PDB site
Description: Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.
Class: replication
Keywords: Winged Helix-turn-Helix motif, Origin binding domain, Protein-Protein Complex, REPLICATION
Deposited on 2005-03-03, released 2005-05-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 32 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA2, REPA2, RPA32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z1da1
  • Chain 'B':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03070 (2-130)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d1z1db1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1z1dA (A:)
gshmansqpsagrapisnpgmseagnfggnsfmpangltvaqnqvlnlikacprpeglnf
qdlknqlkhmsvssikqavdflsneghiystvdddhfkstdae

    Sequence, based on observed residues (ATOM records): (download) 
    >1z1dA (A:)
angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
dhfkstdae

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1z1dB (B:)
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnp