PDB entry 1z1c

View 1z1c on RCSB PDB site
Description: Structural Determinants of Tissue Tropism and In Vivo Pathogenicity for the Parvovirus Minute virus of Mice
Class: Virus/DNA
Keywords: Immunosuppressive strain, MVMi, Minute virus of Mice, Icosahedral virus, Virus-DNA COMPLEX
Deposited on 2005-03-03, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein vp2
    Species: Minute virus of mice [TaxId:10795]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07302 (Start-586)
      • see remark 999 (365)
      • see remark 999 (454)
    Domains in SCOPe 2.07: d1z1ca1
  • Chain 'B':
    Compound: 5'-d(*ap*tp*cp*cp*tp*cp*tp*ap*tp*cp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*cp*ap*cp*cp*ap*ap*ap*a)-3'
  • Heterogens: CA, D5M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1cA (A:)
    msdgtsqpdggnavhsaarveraadgpggsggggsggggvgvstgsydnqthyrflgdgw
    veitalatrlvhlnmpksenycrirvhnttdtsvkgnmakddaheqiwtpwslvdanawg
    vwlqpsdwqyicntmsqlnlvsldqeifnvvlktvteqdsggqaikiynndltacmmvav
    dsnnilpytpaansmetlgfypwkptiaspyryyfcvdrdlsvtyenqegtiehnvmgtp
    kgmnsqfftientqqitllrtgdefatgtyyfdtnpvklthtwqtnrqlgqppllstfpe
    adtdagtltaqgsrhgatqmevnwvseairtrpaqvgfcqphndfeasragpfaapkvpa
    dvtqgmdreangsvrysygkqhgenwaahgpaperytwdetnfgsgrdtrdgfiqsaplv
    vppplngiltnanpigtkndihfsnvfnsygplttfshpspvypqgqiwdkeldlehkpr
    lhitapfvcknnapgqmlvrlgpnltdqydpngatlsrivtygtffwkgkltmraklran
    ttwnpvyqvsvedngnsymsvtkwlptatgnmqsvplitrpvarnty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1cA (A:)
    gvgvstgsydnqthyrflgdgwveitalatrlvhlnmpksenycrirvhnttdtsvkgnm
    akddaheqiwtpwslvdanawgvwlqpsdwqyicntmsqlnlvsldqeifnvvlktvteq
    dsggqaikiynndltacmmvavdsnnilpytpaansmetlgfypwkptiaspyryyfcvd
    rdlsvtyenqegtiehnvmgtpkgmnsqfftientqqitllrtgdefatgtyyfdtnpvk
    lthtwqtnrqlgqppllstfpeadtdagtltaqgsrhgatqmevnwvseairtrpaqvgf
    cqphndfeasragpfaapkvpadvtqgmdreangsvrysygkqhgenwaahgpaperytw
    detnfgsgrdtrdgfiqsaplvvppplngiltnanpigtkndihfsnvfnsygplttfsh
    pspvypqgqiwdkeldlehkprlhitapfvcknnapgqmlvrlgpnltdqydpngatlsr
    ivtygtffwkgkltmraklranttwnpvyqvsvedngnsymsvtkwlptatgnmqsvpli
    trpvarnty
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.