PDB entry 1z1b

View 1z1b on RCSB PDB site
Description: Crystal structure of a lambda integrase dimer bound to a COC' core site
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, DNA binding protein/DNA complex
Deposited on 2005-03-03, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.248
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • engineered (173)
      • modified residue (341)
    Domains in SCOPe 2.07: d1z1ba1, d1z1ba2
  • Chain 'B':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (Start-355)
      • engineered (173)
      • modified residue (341)
    Domains in SCOPe 2.07: d1z1bb1, d1z1bb2
  • Chain 'C':
    Compound: 5'-d(*cp*t*cp*gp*tp*tp*cp*ap*gp*cp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*tp*tp*ap*tp*ap*cp*tp*ap*ap*gp*tp*tp*gp*gp*cp*ap*t)-3'
  • Chain 'E':
    Compound: 29-mer
  • Chain 'F':
    Compound: 25-mer
  • Chain 'G':
    Compound: 25-mer

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1bA (A:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1bA (A:)
    errdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkpltar
    insdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaam
    lngyidegkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylk
    iyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalh
    idalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptf
    helrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z1bB (B:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1bB (B:)
    herrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghkhkplta
    rinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaa
    mlngyidegkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeyl
    kiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptal
    hidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdppt
    fhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.