PDB entry 1z1a

View 1z1a on RCSB PDB site
Description: S. cerevisiae Sir1 ORC-interaction domain
Class: transcription
Keywords: novel fold, TRANSCRIPTION
Deposited on 2005-03-03, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein SIR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21691 (Start-141)
      • modified residue (58)
      • modified residue (62)
      • modified residue (119)
      • engineered (88)
    Domains in SCOPe 2.07: d1z1aa1
  • Chain 'B':
    Compound: Regulatory protein SIR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21691 (Start-141)
      • modified residue (58)
      • modified residue (62)
      • modified residue (119)
      • engineered (88)
    Domains in SCOPe 2.07: d1z1ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1aA (A:)
    gshmenmwaaekkfsteeeyvsprflvadgflidlaeekpinpkdprlltllkdhqrami
    dqmnlvkwndfkkyqdpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyeperm
    tvlascvpillddqtvqylydd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1aA (A:)
    steeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkky
    qdpiplkaktlfkfckqikkkflrgadfklhtlpmtvlascvpillddqtvqylydd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z1aB (B:)
    gshmenmwaaekkfsteeeyvsprflvadgflidlaeekpinpkdprlltllkdhqrami
    dqmnlvkwndfkkyqdpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyeperm
    tvlascvpillddqtvqylydd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1aB (B:)
    eeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqd
    piplkaktlfkfckqikkkflrgadfklhtlpteanmtvlascvpillddqtvqylydd