PDB entry 1z19

View 1z19 on RCSB PDB site
Description: Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, DNA binding protein/DNA complex
Deposited on 2005-03-03, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (0-282)
      • see remark 999 (0)
      • modified residue (27)
      • modified residue (53)
      • engineered (100)
      • modified residue (129)
      • modified residue (145)
      • modified residue (181)
      • modified residue (216)
      • modified residue (264)
    Domains in SCOPe 2.08: d1z19a_
  • Chain 'B':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (0-282)
      • see remark 999 (0)
      • modified residue (27)
      • modified residue (53)
      • engineered (100)
      • modified residue (129)
      • modified residue (145)
      • modified residue (181)
      • modified residue (216)
      • modified residue (264)
      • modified residue (268)
    Domains in SCOPe 2.08: d1z19b_
  • Chain 'C':
    Compound: 5'-d(*cp*tp*cp*gp*tp*tp*cp*ap*gp*cp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(p*tp*tp*tp*ap*tp*ap*cp*tp*ap*ap*gp*tp*tp*gp*gp*cp*ap*tp*tp*a)-3'
  • Chain 'E':
    Compound: 33-mer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z19A (A:)
    mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
    egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
    sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
    smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
    sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z19A (A:)
    mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
    egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
    sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
    smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
    sarlyekqisdkfaqhllghksdtmewdkieik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z19B (B:)
    mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
    egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
    sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
    smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
    sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.