PDB entry 1z18

View 1z18 on RCSB PDB site
Description: Crystal structure analysis of periplasmic Leu/Ile/Val-binding protein with bound valine
Class: transport protein
Keywords: periplasmic binding proteins, alpha-beta fold, aliphatic amino acid binding protein, TRANSPORT PROTEIN
Deposited on 2005-03-03, released 2005-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leu/Ile/Val-binding protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z18a_
  • Heterogens: CD, VAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z18A (A:)
    edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava
    vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
    dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
    dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
    aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
    akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak