PDB entry 1z12

View 1z12 on RCSB PDB site
Description: Crystal Structure of Bovine Low Molecular Weight PTPase Complexed with Vanadate
Class: hydrolase
Keywords: PTPase, Vanadate Complex, Hydrolase
Deposited on 2005-03-03, released 2005-04-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Bos taurus [TaxId:9913]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1z12a_
  • Heterogens: VO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z12A (A:)
    aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr