SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1z12

View 1z12 on RCSB PDB site
Description: Crystal Structure of Bovine Low Molecular Weight PTPase Complexed with Vanadate
Class: hydrolase
Keywords: PTPase, Vanadate Complex, Hydrolase
Deposited on 2005-03-03, released 2005-04-05
The last revision prior to the SCOP 1.75B freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Low molecular weight phosphotyrosine protein phosphatase
Species: Bos taurus [TaxId:9913]
Gene: Acp1
Domains in SCOP 1.75B: d1z12a_
Heterogens: VO4

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1z12A (A:)
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr