PDB entry 1z11

View 1z11 on RCSB PDB site
Description: Crystal Structure of Human Microsomal P450 2A6 with Methoxsalen Bound
Class: oxidoreductase
Keywords: CYP2A6, P450 2A6, P450, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase, heme, methoxsalen
Deposited on 2005-03-02, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome P450, family 2, subfamily A, polypeptide 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11509 (Start-471)
      • expression tag (472-473)
    Domains in SCOPe 2.07: d1z11a1, d1z11a2
  • Chain 'B':
    Compound: cytochrome P450, family 2, subfamily A, polypeptide 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11509 (Start-471)
      • expression tag (472)
    Domains in SCOPe 2.07: d1z11b1, d1z11b2
  • Chain 'C':
    Compound: cytochrome P450, family 2, subfamily A, polypeptide 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z11c_
  • Chain 'D':
    Compound: cytochrome P450, family 2, subfamily A, polypeptide 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z11d_
  • Heterogens: HEM, 8MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z11A (A:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavrealvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgk
    rgieeriqeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsll
    rmmlgifqftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrd
    fflpkgtevypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfge
    glarmelflffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z11A (A:)
    kgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavre
    alvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeri
    qeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgif
    qftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfid
    sflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhe
    eidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgt
    evypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmel
    flffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z11B (B:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavrealvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgk
    rgieeriqeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsll
    rmmlgifqftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrd
    fflpkgtevypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfge
    glarmelflffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z11B (B:)
    klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavreal
    vdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriqe
    eagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifqf
    tststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfidsf
    lirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvheei
    drvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgtev
    ypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelfl
    ffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z11C (C:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavrealvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgk
    rgieeriqeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsll
    rmmlgifqftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrd
    fflpkgtevypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfge
    glarmelflffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z11C (C:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea
    lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq
    eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq
    ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte
    vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf
    lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z11D (D:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavrealvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgk
    rgieeriqeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsll
    rmmlgifqftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrd
    fflpkgtevypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfge
    glarmelflffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z11D (D:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea
    lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq
    eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq
    ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte
    vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf
    lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr