PDB entry 1z0x

View 1z0x on RCSB PDB site
Description: Crystal structure of transcriptional regulator, tetR Family from Enterococcus faecalis V583
Class: transcription
Keywords: tetR, transcriptional regulator, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-03-02, released 2005-04-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Enterococcus faecalis V583
    Gene: EF0787
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837P6 (Start-219)
      • modified residue (28)
      • modified residue (56)
      • modified residue (81)
      • modified residue (115-116)
      • modified residue (128)
      • modified residue (143)
      • modified residue (145)
      • modified residue (171)
      • modified residue (183)
    Domains in SCOP 1.75: d1z0xa1, d1z0xa2
  • Chain 'B':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Enterococcus faecalis V583
    Gene: EF0787
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837P6
      • modified residue (28)
      • modified residue (56)
      • modified residue (81)
      • modified residue (115-116)
      • modified residue (128)
      • modified residue (143)
      • modified residue (145)
      • modified residue (171)
      • modified residue (183)
    Domains in SCOP 1.75: d1z0xb1, d1z0xb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0xA (A:)
    mepklskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaea
    ieehfqepalcgewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgil
    reagfspemthlavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdne
    ltymeesiqfrhsihqksafiqavktyldglqadntsssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0xA (A:)
    klskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaeaiee
    hfqepalcgewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilrea
    gfspemthlavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdnelty
    meesiqfhsihqksafiqavktyldglqadntsssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0xB (B:)
    mepklskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaea
    ieehfqepalcgewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgil
    reagfspemthlavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdne
    ltymeesiqfrhsihqksafiqavktyldglqadntsssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0xB (B:)
    pklskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaeaie
    ehfqepalcgewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilre
    agfspemthlavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdnelt
    ymeesiqfrihqksafiqavktyldglqad