PDB entry 1z0u

View 1z0u on RCSB PDB site
Description: Crystal structure of a NAD kinase from Archaeoglobus fulgidus bound by NADP
Class: transferase
Keywords: NAD kinase, ATP-binding, NAD, NADP, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, TRANSFERASE
Deposited on 2005-03-02, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable inorganic polyphosphate/ATP-NAD kinase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z0ua_
  • Chain 'B':
    Compound: Probable inorganic polyphosphate/ATP-NAD kinase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z0ub_
  • Heterogens: SO4, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0uA (A:)
    mgsshhhhhhdydipttenlyfqggggggmraavvyktdghvkrieealkrlevevelfn
    qpseelenfdfivsvggdgtilrilqklkrcppifgintgrvgllthaspenfevelkka
    vekfeverfprvscsampdvlalneiavlsrkpakmidvalrvdgvevdrircdgfivat
    qigstgyafsaggpvvepylecfilipiapfrfgwkpyvvsmerkieviaekaivvadgq
    ksvdfdgeitieksefpavffknekrfrnlfgkvrsig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0uA (A:)
    mraavvyktdghvkrieealkrlevevelfnqpseelenfdfivsvggdgtilrilqklk
    rcppifgintgrvgllthaspenfevelkkavekfeverfprvscsampdvlalneiavl
    srkpakmidvalrvdgvevdrircdgfivatqigstgyafsaggpvvepylecfilipia
    pfrfgwkpyvvsmerkieviaekaivvadgqksvdfdgeitieksefpavffknekrfrn
    lfgkvrsig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0uB (B:)
    mgsshhhhhhdydipttenlyfqggggggmraavvyktdghvkrieealkrlevevelfn
    qpseelenfdfivsvggdgtilrilqklkrcppifgintgrvgllthaspenfevelkka
    vekfeverfprvscsampdvlalneiavlsrkpakmidvalrvdgvevdrircdgfivat
    qigstgyafsaggpvvepylecfilipiapfrfgwkpyvvsmerkieviaekaivvadgq
    ksvdfdgeitieksefpavffknekrfrnlfgkvrsig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0uB (B:)
    mraavvyktdghvkrieealkrlevevelfnqpseelenfdfivsvggdgtilrilqklk
    rcppifgintgrvgllthaspenfevelkkavekfeverfprvscsampdvlalneiavl
    srkpakmidvalrvdgvevdrircdgfivatqigstgyafsaggpvvepylecfilipia
    pfrfgwkpyvvsmerkieviaekaivvadgqksvdfdgeitieksefpavffknekrfrn
    lfgkvrsig