PDB entry 1z0r

View 1z0r on RCSB PDB site
Description: Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transcription-State Regulator AbrB
Class: transcription
Keywords: SCOP database, N-terminal DNA-binding domain, transition state regulator, TRANSCRIPTION
Deposited on 2005-03-02, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transition state regulatory protein abrB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z0ra_
  • Chain 'B':
    Compound: Transition state regulatory protein abrB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z0rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z0rA (A:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z0rB (B:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt