PDB entry 1z0r

View 1z0r on RCSB PDB site
Description: Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transcription-State Regulator AbrB
Class: transcription
Keywords: SCOP database, N-terminal DNA-binding domain, transition state regulator, TRANSCRIPTION
Deposited on 2005-03-02, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transition state regulatory protein abrB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ABRB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08874 (0-52)
  Domains in SCOPe 2.08: d1z0ra_
• Chain 'B':
  Compound: Transition state regulatory protein abrB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ABRB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08874 (0-52)
  Domains in SCOPe 2.08: d1z0rb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z0rA (A:)
  mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z0rB (B:)
  mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt