PDB entry 1z0p

View 1z0p on RCSB PDB site
Description: Crystal structure of the Protein of Unknown Function SPY1572 from Streptococcus pyogenes
Class: structural genomics, unknown function
Keywords: Streptococcus pyogenes, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-03-02, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SPy1572
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: gi:13622656
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z0pa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1z0pA (A:)
msyekeflkdfedwvktqiqvnqlamatsqevaqedgderakdafiryeskldayefllg
kfdnykngkafhdipdelfgarhy

    Sequence, based on observed residues (ATOM records): (download) 
    >1z0pA (A:)
msyekeflkdfedwvktqiqvnqlamatsqevaderakdafiryeskldayefllgkfdn
ykngkafhdipde