PDB entry 1z0n

View 1z0n on RCSB PDB site
Description: the glycogen-binding domain of the AMP-activated protein kinase
Class: sugar binding protein
Keywords: beta sandwich
Deposited on 2005-03-02, released 2005-10-25
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.184
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386 (Start-95)
      • engineered (37)
    Domains in SCOP 1.75: d1z0na1
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386
      • engineered (37)
    Domains in SCOP 1.75: d1z0nb1
  • Chain 'C':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386
      • engineered (37)
    Domains in SCOP 1.75: d1z0nc1
  • Heterogens: BCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0nA (A:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nA (A:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvkktdfevf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0nB (B:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nB (B:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0nC (C:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nC (C:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvk