PDB entry 1z0n

View 1z0n on RCSB PDB site
Description: the glycogen-binding domain of the AMP-activated protein kinase
Class: sugar binding protein
Keywords: beta sandwich, SUGAR BINDING PROTEIN
Deposited on 2005-03-02, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386 (Start-95)
      • engineered (37)
    Domains in SCOPe 2.07: d1z0na1
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386
      • engineered (37)
    Domains in SCOPe 2.07: d1z0nb_
  • Chain 'C':
    Compound: 5'-AMP-activated protein kinase, beta-1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386
      • engineered (37)
    Domains in SCOPe 2.07: d1z0nc_
  • Heterogens: BCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0nA (A:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nA (A:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvkktdfevf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0nB (B:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nB (B:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0nC (C:)
    evnekapaqarptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykf
    fvdgqwthdpsepivtsqlgtvnniiqvkktdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0nC (C:)
    arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd
    psepivtsqlgtvnniiqvk