PDB entry 1z0k

View 1z0k on RCSB PDB site
Description: Structure of GTP-Bound Rab4Q67L GTPase in complex with the central Rab binding domain of Rabenosyn-5
Class: protein transport
Keywords: Rab GTPases, Rab4, Rabenosyn, effector complex, vesicular trafficking, protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.225
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20338 (Start-171)
      • engineered (66)
    Domains in SCOPe 2.01: d1z0ka1
  • Chain 'B':
    Compound: FYVE-finger-containing Rab5 effector protein rabenosyn-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z0kb1
  • Chain 'C':
    Compound: GTP-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20338 (Start-171)
      • engineered (66)
    Domains in SCOPe 2.01: d1z0kc_
  • Chain 'D':
    Compound: FYVE-finger-containing Rab5 effector protein rabenosyn-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z0kd_
  • Heterogens: MG, GTP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0kA (A:)
    gsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklq
    iwdtaglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcg
    nkkdldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0kA (A:)
    tydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwd
    taglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkk
    dldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0kB (B:)
    gplgsaegwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqd
    eydqqqtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0kB (B:)
    egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
    t
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0kC (C:)
    gsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklq
    iwdtaglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcg
    nkkdldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0kC (C:)
    ydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwdt
    aglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkd
    ldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z0kD (D:)
    gplgsaegwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqd
    eydqqqtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0kD (D:)
    egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
    t