PDB entry 1z0j

View 1z0j on RCSB PDB site
Description: Structure of GTP-Bound Rab22Q64L GTPase in complex with the minimal Rab binding domain of Rabenosyn-5
Class: protein transport
Keywords: Rab Effector, Rab GTPase, Rab22 GTPase, Rabenosyn, Endosomal trafficking, Protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.215
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-22A
    Species: Mus musculus [TaxId:10090]
    Gene: Rab22a, Rab22
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35285 (2-End)
      • cloning artifact (0-1)
      • see remark 999 (22)
      • engineered (64)
    Domains in SCOPe 2.05: d1z0ja1
  • Chain 'B':
    Compound: FYVE-finger-containing Rab5 effector protein rabenosyn-5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB NP_071735 (Start-58)
    Domains in SCOPe 2.05: d1z0jb1
  • Heterogens: MG, GTP, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0jA (A:)
    gsalrelkvcllgdtgvgkssimwrfvedsfdpninptigasfmtktvqyqnelhkfliw
    dtaglerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnk
    cdltdvrevmerdakdyadsihaifvetsaknaininelfieisrripst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0jA (A:)
    gsalrelkvcllgdtgvgkssimwrfvedsfdpninptigasfmtktvqyqnelhkfliw
    dtaglerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnk
    cdltdvrevmerdakdyadsihaifvetsaknaininelfieisrrips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0jB (B:)
    gspeaeepieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0jB (B:)
    ieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd