PDB entry 1z0i

View 1z0i on RCSB PDB site
Description: GDP-Bound Rab21 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab21, Vesicular trafficking, Protein Transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-21
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0ia_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0iA (A:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0iA (A:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
    piyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
    eaesyaesvgakhyhtsakqnkgieelfldlckrmiet