PDB entry 1z0f

View 1z0f on RCSB PDB site
Description: GDP-Bound Rab14 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab14, Vesicular trafficking, Protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAB14, member RAS oncogene family
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0fa_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0fA (A:)
    gplgsatapynysyifkyiiigdmgvgkscllhqftekkfmadcphtigvefgtriievs
    gqkiklqiwdtagqerfravtrsyyrgaagalmvyditrrstynhlsswltdarnltnpn
    tviilignkadleaqrdvtyeeakqfaeengllfleasaktgenvedafleaakkiyqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0fA (A:)
    nysyifkyiiigdmgvgkscllhqftekkfmadcphtigvefgtriievsgqkiklqiwd
    tagqerfravtrsyyrgaagalmvyditrrstynhlsswltdarnltnpntviilignka
    dleaqrdvtyeeakqfaeengllfleasaktgenvedafleaakkiy