PDB entry 1z0e

View 1z0e on RCSB PDB site
Description: Crystal Structure of A. fulgidus Lon proteolytic domain
Class: hydrolase
Keywords: ATP-DEPENDENT PROTEASE, CATALYTIC SER-LYS DYAD, B-type Lon, HYDROLASE
Deposited on 2005-03-01, released 2005-08-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0ea_
  • Chain 'B':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0eb_
  • Chain 'C':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0ec_
  • Chain 'D':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0ed_
  • Chain 'E':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0ee_
  • Chain 'F':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z0ef_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0eA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eA (A:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0eB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eB (B:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0eC (C:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eC (C:)
    lfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsai
    ikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsvk
    gevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehvl
    edgkkknrlmskfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z0eD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eD (D:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z0eE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eE (E:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z0eF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
    vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
    lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
    ehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0eF (F:)
    klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
    iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
    kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
    ledgkkknrlmskfk