PDB entry 1z0d

View 1z0d on RCSB PDB site
Description: GDP-Bound Rab5c GTPase
Class: protein transport
Keywords: Rab GTPase, Rab5c, vesicular trafficking, protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-5C
    Species: Mus musculus [TaxId:10090]
    Gene: Rab5c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35278 (2-166)
      • engineered (63)
    Domains in SCOPe 2.01: d1z0da1
  • Chain 'C':
    Compound: Ras-related protein Rab-5C
    Species: Mus musculus [TaxId:10090]
    Gene: Rab5c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35278 (2-166)
      • engineered (63)
    Domains in SCOPe 2.01: d1z0dc_
  • Heterogens: PO4, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0dA (A:)
    gsicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwd
    tagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnka
    dlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0dA (A:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakklp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0dC (C:)
    gsicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwd
    tagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnka
    dlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0dC (C:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakklp