PDB entry 1z0b

View 1z0b on RCSB PDB site
Description: Crystal Structure of A. fulgidus Lon proteolytic domain E506A mutant
Class: hydrolase
Keywords: ATP-DEPENDENT PROTEASE, CATALYTIC SER-LYS DYAD, B-type Lon, HYDROLASE
Deposited on 2005-03-01, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.18
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog type
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29883 (Start-206)
      • engineered (91)
    Domains in SCOPe 2.04: d1z0ba_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0bA (A:)
    dyklfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareav
    mnvsaiikkytgrdisnmdvhiqfvgtyegvagdsasisiatavisaiegipvdqsvamt
    gslsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrine
    vlehvledgkkknrlmskfkelelaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0bA (A:)
    yklfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvs
    aiikkytgrdisnmdvhiqfvgtyegvagdsasisiatavisaiegipvdqsvamtgsls
    vkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevleh
    vledgkkknrlmskfkelelaav