PDB entry 1z0a

View 1z0a on RCSB PDB site
Description: GDP-Bound Rab2A GTPase
Class: protein transport
Keywords: Rab GTPase, Rab2, Vesicular trafficking, protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-2A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB2, RAB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0aa1
  • Chain 'B':
    Compound: Ras-related protein Rab-2A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB2, RAB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0ab_
  • Chain 'C':
    Compound: Ras-related protein Rab-2A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB2, RAB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0ac_
  • Chain 'D':
    Compound: Ras-related protein Rab-2A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB2, RAB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z0ad_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z0aA (A:)
    gplgsayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqik
    lqiwdtagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmviml
    ignksdlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0aA (A:)
    ayaylfkyiiigdtgvgksclllqftdkrfqdltigvefgarmitidgkqiklqiwdtag
    qesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdle
    srrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z0aB (B:)
    gplgsayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqik
    lqiwdtagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmviml
    ignksdlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0aB (B:)
    yaylfkyiiigdtgvgksclllqftdkrfdltigvefgarmitidgkqiklqiwdtagqe
    sfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdlesr
    revkkeegeafarehglifmetsaktasnveeafintakeiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z0aC (C:)
    gplgsayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqik
    lqiwdtagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmviml
    ignksdlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0aC (C:)
    ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd
    tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks
    dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z0aD (D:)
    gplgsayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqik
    lqiwdtagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmviml
    ignksdlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z0aD (D:)
    yaylfkyiiigdtgvgksclllqftdltigvefgarmitidgkqiklqiwdtagqesfrs
    itrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdlesrrevk
    keegeafarelifmetsaktasnveeafintakeiyek