PDB entry 1z08

View 1z08 on RCSB PDB site
Description: GppNHp-Bound Rab21 Q53G mutant GTPase
Class: protein transport
Keywords: Rab GTPase, Rab21, Vesicular trafficking, Protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-21
    Species: HOMO SAPIENS
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL25 (Start-169)
      • engineered (39)
    Domains in SCOP 1.73: d1z08a1
  • Chain 'B':
    Compound: Ras-related protein Rab-21
    Species: HOMO SAPIENS
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL25 (Start-169)
      • engineered (39)
    Domains in SCOP 1.73: d1z08b1
  • Chain 'C':
    Compound: Ras-related protein Rab-21
    Species: HOMO SAPIENS
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL25 (Start-169)
      • engineered (39)
    Domains in SCOP 1.73: d1z08c1
  • Chain 'D':
    Compound: Ras-related protein Rab-21
    Species: HOMO SAPIENS
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UL25 (Start-169)
      • engineered (39)
    Domains in SCOP 1.73: d1z08d1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z08A (A:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z08A (A:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
    gqpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvs
    iqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z08B (B:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z08B (B:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
    gqyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
    eaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z08C (C:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z08C (C:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
    gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
    ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z08D (D:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z08D (D:)
    ysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdtag
    qerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidle
    kerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet