PDB entry 1z07

View 1z07 on RCSB PDB site
Description: GppNHp-Bound Rab5c G55Q mutant GTPase
Class: protein transport
Keywords: Rab GTPase, Rab5, Vesicular trafficking, Protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-5C
    Species: Mus musculus [TaxId:10090]
    Gene: Rab5c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35278 (2-165)
      • cloning artifact (1)
      • engineered (38)
    Domains in SCOPe 2.01: d1z07a1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z07A (A:)
    gsicqfklvllgesavgksslvlrfvkgqfheyqestiqaafltqtvclddttvkfeiwd
    tagqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnka
    dlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z07A (A:)
    sicqfklvllgesavgksslvlrfvkgqfheyqestiqaafltqtvclddttvkfeiwdt
    agqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkad
    laskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl