PDB entry 1z06

View 1z06 on RCSB PDB site
Description: GppNHp-Bound Rab33 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab33b GTPase, vesicular trafficking, protein transport
Deposited on 2005-03-01, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-33B
    Species: MUS MUSCULUS
    Gene: Rab33b
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z06a1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z06A (A:)
    mghhhhhhgslvprgsrsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfrer
    avdidgerikiqlwdtagqerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeck
    qhllandiprilvgnkcdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifm
    tlahklksh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z06A (A:)
    rifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdtag
    qerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnkcd
    lrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtla