PDB entry 1z05

View 1z05 on RCSB PDB site
Description: Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
Class: transcription
Keywords: ROK family, transcriptional regulator, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2005-03-01, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, ROK family
    Species: Vibrio cholerae [TaxId:243277]
    Gene: AAF95155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z05a1, d1z05a2, d1z05a3
  • Heterogens: ZN, SO4, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z05A (A:)
    mhhhhhhssgvdlgtenlyfqsnamymaqpghidhikqinagrvyklidqkgpisridls
    keselapasitkitrelidahlihettvqeaisrgrpavglqtnnlgwqflsmrlgrgyl
    tialhelggevlidtkidiheidqddvlarllfeieeffqtyaaqldrvtsiaitlpglv
    nseqgivlqmphynvknlalgpeiykatglpvfvandtrawalaeklfghsqdvdnsvli
    sihhglgagivldgrvlqgrhgnigelghiqidpqgkrchcgnygcletvassqairdqv
    tariqagepsclatveeisiedicaaaadgdplavdviqqlgrylgaaiaivinlfnpek
    iliggvinqaksilypsieqcireqslpvyhqdlklvesrfykqatmpgaalikqalydg
    lllmkvveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z05A (A:)
    dhikqinagrvyklidqkgpisridlskeselapasitkitrelidahlihettvqeais
    rgrpavglqtnnlgwqflsmrlgrgyltialhelggevlidtkidiheidqddvlarllf
    eieeffqtyaaqldrvtsiaitlpglvnseqgivlqmphynvknlalgpeiykatglpvf
    vandtrawalaeklfghsqdvdnsvlisihhglgagivldgrvlqgrhgnigelghiqid
    pqgkrchcgnygcletvassqairdqvtariqagepsclatveeisiedicaaaadgdpl
    avdviqqlgrylgaaiaivinlfnpekiliggvinqaksilypsieqcireqslpvyhqd
    lklvesrfykqatmpgaalikqalydglllmkvveg