PDB entry 1z02

View 1z02 on RCSB PDB site
Description: 2-Oxoquinoline 8-Monooxygenase Component: Active site Modulation by Rieske-[2fe-2S] Center Oxidation/Reduction
Class: oxidoreductase
Keywords: Monooxygenase, Rieske Center, Oxygen Binding/Activation, Substrate bound complex, OXIDOREDUCTASE
Deposited on 2005-03-01, released 2005-05-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02a1, d1z02a2
  • Chain 'B':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02b1, d1z02b2
  • Chain 'C':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02c1, d1z02c2
  • Chain 'D':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02d1, d1z02d2
  • Chain 'E':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02e1, d1z02e2
  • Chain 'F':
    Compound: 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z02f1, d1z02f2
  • Heterogens: FE, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z02A (A:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02A (A:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z02B (B:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02B (B:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z02C (C:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02C (C:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z02D (D:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02D (D:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z02E (E:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02E (E:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z02F (F:)
    msdqpiirrrqvktgisdarannaktqsqyqpykdaawgfinhwypalftheleedqvqg
    iqicgvpivlrrvngkvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklv
    tivanpedkligttgvttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqf
    phplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlpl
    gllptsddciavvedddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpg
    vlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhg
    fndsdlyareamqnfyydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavk
    dtslifkqtadgkrpgykveqikedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z02F (F:)
    isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
    kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
    vttypvhevngmifvfvreddfpdedvpplahdlpfrfperseqfphplwpsspsvlddn
    avvhgmhrtgfgnwriacengfdnahilvhkdntivhamdwvlplgllptsddciavved
    ddgpkgmmqwlftdkwapvlenqelglkveglkgrhyrtsvvlpgvlmvenwpeehvvqy
    ewyvpitddtheyweilvrvcptdedrkkfqyrydhmykplclhgfndsdlyareamqnf
    yydgtgwddeqlvatdispitwrklasrwnrgiakpgrgvagavkdtslifkqtadgkrp
    gykveqi