PDB entry 1z00

View 1z00 on RCSB PDB site
Description: Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal domain of XPF
Class: hydrolase
Keywords: helix-hairpin-helix
Deposited on 2005-03-01, released 2005-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA excision repair protein ERCC-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07992 (1-78)
      • initiating methionine (0)
      • his tag (79-83)
    Domains in SCOP 1.73: d1z00a1
  • Chain 'B':
    Compound: DNA repair endonuclease XPF
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92889 (1-83)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1z00b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z00A (A:)
    madllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglg
    pqkarrlfdvlhepflkvpgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z00A (A:)
    madllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglg
    pqkarrlfdvlhepflkvpggleh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z00B (B:)
    mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
    nakqlydfihtsfaevvskgkgkk