PDB entry 1yzz

View 1yzz on RCSB PDB site
Description: Humanized caban33 at room temperature
Class: unknown function
Keywords: antibody, camel antibody, humanization, UNKNOWN FUNCTION
Deposited on 2005-03-01, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-VSG immunoglobulin heavy chain variable domain cAbAn33
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB AAP22644 (0-End)
      • conflict (36)
      • conflict (43-44)
    Domains in SCOPe 2.07: d1yzza1, d1yzza2
  • Chain 'B':
    Compound: anti-VSG immunoglobulin heavy chain variable domain cAbAn33
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • GB AAP22644 (0-End)
      • conflict (36)
      • conflict (43-44)
    Domains in SCOPe 2.07: d1yzzb1, d1yzzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzzA (A:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvsshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzzA (A:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgsireywgqgtqvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yzzB (B:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvsshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzzB (B:)
    dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
    dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvireywgqgtqvtvs