PDB entry 1yzy

View 1yzy on RCSB PDB site
Description: Crystal structure of Haemophilus influenzae protein HI1011, Pfam DUF1537
Class: structural genomics, unknown function
Keywords: PUTATIVE TRNA SYNTHASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2005-02-28, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HI1011
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1011
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yzya1
  • Chain 'B':
    Compound: Hypothetical protein HI1011
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1011
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yzyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzyA (A:)
    mlgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaie
    qslrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngr
    tifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvq
    ecfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtna
    ftptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianlds
    efapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssi
    vvqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzyA (A:)
    lgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaieq
    slrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngrt
    ifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvqe
    cfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtnaf
    tptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianldse
    fapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssiv
    vqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yzyB (B:)
    mlgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaie
    qslrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngr
    tifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvq
    ecfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtna
    ftptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianlds
    efapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssi
    vvqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzyB (B:)
    lgviaddftgasdiasflvenglstvqmngvptqslnskvdaivislksrsnpvneaieq
    slrayqwlkengctqfyfkycstfdstakgnigpvtdalldelnedftvitpalpvngrt
    ifngylfvgdvllsesgmknhpitpmvdanlmrlmdaqakgktglvayadvikgasrvqe
    cfaelkaqgyryavvdavdnsqlevlaeavadfklvtggsglgaymaarlsggkkgtnaf
    tptkgktvvlsgscsvmtnkqvekyrekaphfqldveqaihnenyieqlyqwvianldse
    fapmvyatvppdalkaiqhqfgvdqashaientfaklaaklkqygvtnfitaggetssiv
    vqelgftgfhigkqiapgvpwlkaveediflalksgnfgkedffeyaqgmfl