PDB entry 1yzx

View 1yzx on RCSB PDB site
Description: Crystal structure of human kappa class glutathione transferase
Class: transferase
Keywords: transferase, glutathione sulfinate, peroxidase
Deposited on 2005-02-28, released 2005-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase kappa 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yzxa_
  • Chain 'B':
    Compound: Glutathione S-transferase kappa 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yzxb_
  • Heterogens: GSF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzxA (A:)
    mgplprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllp
    rkglymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasre
    lwmrvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacryga
    fglpitvahvdgqthmlfgsdrmellahllgekwmgpippavnarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzxA (A:)
    lprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllprkg
    lymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasrelwm
    rvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacrygafgl
    pitvahvdgqthmlfgsdrmellahllgekwmgpippa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yzxB (B:)
    mgplprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllp
    rkglymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasre
    lwmrvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacryga
    fglpitvahvdgqthmlfgsdrmellahllgekwmgpippavnarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzxB (B:)
    lprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllprkg
    lymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasrelwm
    rvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacrygafgl
    pitvahvdgqthmlfgsdrmellahllgekwmgpippa