PDB entry 1yzw

View 1yzw on RCSB PDB site
Description: The 2.1A Crystal Structure of the Far-red Fluorescent Protein HcRed: Inherent Conformational Flexibility of the Chromophore
Class: luminescent protein
Keywords: luminescent protein
Deposited on 2005-02-28, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85
      • see remark 999 (35)
      • chromophore (62)
      • see remark 999 (119)
      • see remark 999 (140)
      • see remark 999 (165)
      • see remark 999 (170)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1yzwa_
  • Chain 'B':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85
      • see remark 999 (35)
      • chromophore (62)
      • see remark 999 (119)
      • see remark 999 (140)
      • see remark 999 (165)
      • see remark 999 (170)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1yzwb_
  • Chain 'C':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85
      • see remark 999 (35)
      • chromophore (62)
      • see remark 999 (119)
      • see remark 999 (140)
      • see remark 999 (165)
      • see remark 999 (170)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1yzwc_
  • Chain 'D':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85
      • see remark 999 (35)
      • chromophore (62)
      • see remark 999 (119)
      • see remark 999 (140)
      • see remark 999 (165)
      • see remark 999 (170)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1yzwd_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzwA (A:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzwA (A:)
    gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
    esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
    nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
    altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yzwB (B:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzwB (B:)
    gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
    esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
    nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
    altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yzwC (C:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzwC (C:)
    gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
    esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
    nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
    altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yzwD (D:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzwD (D:)
    gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
    esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
    nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
    altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek