PDB entry 1yzv

View 1yzv on RCSB PDB site
Description: hypothetical protein from trypanosoma cruzi
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, UNKNOWN FUNCTION
Deposited on 2005-02-28, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yzva_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzvA (A:)
    mahhhhhhmsrllkhygscktaffccdiqekfmgriansancvfvanrfaglhtalgtah
    svyivteqypkglgatsadirlppdahvfskkrfamlvpqvmplvdlpeveqvvlwgfet
    hvcilqtaaalldmkkkvviavdgcgsqsqgdhctaiqlmqswsgdgcyistsesilmql
    lkdasdpvfktiaplmkqthpiri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzvA (A:)
    srllkhygscktaffccdiqekfmgriansancvfvanrfaglhtalgtahsvyivteqy
    pkglgatsadirlppdahvfskkrfamlvpqvmplvdlpeveqvvlwgfethvcilqtaa
    alldmkkkvviavdgcgsqsqgdhctaiqlmqswsgdgcyistsesilmqllkdasdpvf
    ktiaplmkqthpiri