PDB entry 1yzu

View 1yzu on RCSB PDB site
Description: GppNHp-Bound Rab21 GTPase at 2.50 A Resolution
Class: protein transport
Keywords: Rab GTPase, Rab21, Vesicular trafficking, Protein transport
Deposited on 2005-02-28, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-21
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yzua_
  • Chain 'B':
    Compound: Ras-related protein Rab-21
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yzub_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzuA (A:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzuA (A:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
    gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
    ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yzuB (B:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzuB (B:)
    aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
    gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
    ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmi