PDB entry 1yzs

View 1yzs on RCSB PDB site
Description: Solution structure of human sulfiredoxin (srx)
Class: oxidoreductase
Keywords: ParB domain fold, OXIDOREDUCTASE
Deposited on 2005-02-28, released 2005-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfiredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: C20orf139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yzsa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yzsA (A:)
gapegpgpsggaqggsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsv
ppidvlwikgaqggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdl
q