PDB entry 1yzq

View 1yzq on RCSB PDB site
Description: GppNHp-Bound Rab6 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab6, Vesicular trafficking, Protein transport
Deposited on 2005-02-28, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.232
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: small GTP binding protein RAB6 isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yzqa1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzqA (A:)
    gsplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtirlqlw
    dtagqerfrslipsyirdsaaavvvyditnvnsfqqttkwiddvrtergsdviimlvgnk
    tdladkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzqA (A:)
    fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtirlqlwdtagqe
    rfrslipsyirdsaaavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
    rqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgm