PDB entry 1yzn

View 1yzn on RCSB PDB site
Description: GppNHp-Bound Ypt1p GTPase
Class: protein transport
Keywords: Rab GTPase, Ypt1p GTPase, vesicular trafficking, Protein transport
Deposited on 2005-02-28, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YPT1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YPT1, YP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01123 (15-184)
      • cloning artifact (7-14)
    Domains in SCOPe 2.07: d1yzna2, d1yzna3
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yznA (A:)
    mghhhhhhgslvprgseydylfklllignsgvgksclllrfsddtytndyistigvdfki
    ktveldgktvklqiwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeid
    ryatstvlkllvgnkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmar
    qikes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yznA (A:)
    hgslvprgseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldg
    ktvklqiwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstv
    lkllvgnkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikes