PDB entry 1yzm

View 1yzm on RCSB PDB site
Description: Structure of Rabenosyn (458-503), Rab4 binding domain
Class: protein transport
Keywords: Rab Effector, Rabenosyn, Rab GTPase, vesicular trafficking, protein transport
Deposited on 2005-02-28, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FYVE-finger-containing Rab5 effector protein rabenosyn-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H1K0 (5-End)
      • cloning artifact (3-4)
    Domains in SCOPe 2.07: d1yzma1, d1yzma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yzmA (A:)
    gplgspllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqqtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yzmA (A:)
    gspllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqqt