PDB entry 1yzg

View 1yzg on RCSB PDB site
Description: Structure of Human ADP-ribosylation factor-like 8
Class: transport protein
Keywords: TRANSPORT PROTEIN; GDP-BINDING; MEMBRANE TRAFFICKING, Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics Consortium, SGC
Deposited on 2005-02-28, released 2005-03-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yzga1
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yzgA (A:)
mglifaklwslfcnqehkviivgldnagkttilyqflmnevvhtsptigsnveeivvknt
hflmwdiggqeslrsswntyysntefiilvvdsidrerlaitkeelyrmlahedlrkaav
lifankqdmkgcmtaaeiskyltlssikdhpwhiqsccaltgeglcqglewmtsrigvr

    Sequence, based on observed residues (ATOM records): (download) 
    >1yzgA (A:)
aklwslfcnqehkviivgldnagkttilyqflmnevvhtsptigsnveeivvknthflmw
diggqeslrsswntyysntefiilvvdsidrerlaitkeelyrmlahedlrkaavlifan
kqdmkgcmtaaeiskyltlssikdhpwhiqsccaltgeglcqglewmt