PDB entry 1yze

View 1yze on RCSB PDB site
Description: Crystal structure of the N-terminal domain of USP7/HAUSP.
Deposited on 2005-02-28, released 2005-04-05
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.325
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yzeA (A:)
    gshtaeedmeddtswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrp
    hqksvgfflqcnaesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnf
    mawsevtdpekgfidddkvtfevfvqadaphgvaw
    

    Sequence, based on observed residues (ATOM records):
    >1yzeA (A:)
    wrseatfqftverfvlsppcfvrnlpwkimvmprvgfflqcnaesdstswschaqavlki
    ifsrrishlffhkendwgfsnfmawkvtfevfvqadaphgv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yzeB (B:)
    gshtaeedmeddtswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrp
    hqksvgfflqcnaesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnf
    mawsevtdpekgfidddkvtfevfvqadaphgvaw
    

    Sequence, based on observed residues (ATOM records):
    >1yzeB (B:)
    seatfqftverfvlsppcfvrnlpwkimvmprvgfflqcnaesswschaqavlkiinfsr
    rishlffhkendwgfsnfmawsevtfevfvqadaphgva
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yzeC (C:)
    gshtaeedmeddtswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrp
    hqksvgfflqcnaesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnf
    mawsevtdpekgfidddkvtfevfvqadaphgvaw
    

    Sequence, based on observed residues (ATOM records):
    >1yzeC (C:)
    seatfqftvlsppcfvrnlpwkimvmvgfflqcnaesdstswschaqavlkiinfsrris
    hlffhkendwgfsnfmawsevkvtfevfvqadaphgva