PDB entry 1yzb

View 1yzb on RCSB PDB site
Description: Solution structure of the Josephin domain of Ataxin-3
Deposited on 2005-02-28, released 2005-07-05
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Machado-Joseph disease protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yzbA (A:)
    mesifhekqegslcaqhclnnllqgeyfspvelssiahqldeeermrmaeggvtsedyrt
    flqqpsgnmddsgffsiqvisnalkvwglelilfnspeyqrlridpinersficnykehw
    ftvrklgkqwfnlnslltgpelisdtylalflaqlqqegysifvvkgdlpdceadqllqm
    ir