PDB entry 1yz9

View 1yz9 on RCSB PDB site
Description: Crystal structure of RNase III mutant E110Q from Aquifex aeolicus complexed with double stranded RNA at 2.1-Angstrom Resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, double-stranded RNA, RNA interference, endonucleolytic cleavage
Deposited on 2005-02-28, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082 (0-End)
      • engineered (109)
    Domains in SCOP 1.73: d1yz9a1, d1yz9a2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • engineered (109)
    Domains in SCOP 1.73: d1yz9b1, d1yz9b2
  • Chain 'C':
    Compound: 5'-r(*cp*gp*ap*ap*cp*up*up*cp*gp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-r(*cp*gp*ap*ap*cp*up*up*cp*gp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-r(*cp*gp*ap*ap*cp*up*up*cp*gp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-r(*cp*gp*ap*ap*cp*up*up*cp*gp*cp*g)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yz9A (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz9A (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yz9B (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz9B (B:)
    mleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspnk
    regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfqalwaavyidsgr
    danftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhkk
    kfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.