PDB entry 1yz8

View 1yz8 on RCSB PDB site
Description: Solution structure of the k50 class homeodomain pitx2 bound to dna and implications for mutations that cause rieger syndrome
Class: transcription/DNA
Keywords: DNA binding protein, transcription-DNA complex
Deposited on 2005-02-28, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*cp*gp*gp*gp*gp*ap*tp*tp*ap*gp*ap*gp*c)-3'
  • Chain 'B':
    Compound: 5'-d(*gp*cp*tp*cp*tp*ap*ap*tp*cp*cp*cp*cp*g)-3'
  • Chain 'P':
    Compound: Pituitary homeobox 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PITX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99697 (2-61)
      • cloning artifact (0-1)
      • cloning artifact (62-67)
    Domains in SCOPe 2.08: d1yz8p2, d1yz8p3, d1yz8p4

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yz8P (P:)
    gsqrrqrthftsqqlqqleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrk
    reefivtd