PDB entry 1yz6

View 1yz6 on RCSB PDB site
Description: Crystal structure of intact alpha subunit of aIF2 from Pyrococcus abyssi
Deposited on 2005-02-28, released 2005-06-28
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: 0.249
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable translation initiation factor 2 alpha subunit
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yz6A (A:)
    prrareypeegefvvatvkrihnygafleldeypgkeafmhisevastwvrnirdylkeg
    qkvvakvirvdprkghidlslrrvtqqqrkaklqefkraqkaenllklaaeklgkdfeta
    wrevwvpleeewgevyaafedaakdgidvlkghvpdewlpvlkeiidnyvevptvtidae
    feitvpkpngveiikealirardrankekdvevkftylgapryriditapdyykaeevle
    siaeeilrvikeaggeatllrkekrikkvkkrkk
    

    Sequence, based on observed residues (ATOM records):
    >1yz6A (A:)
    areypeegefvvatvkrihnygafleldeypgkeafmhisevastwvrnirdylkegqkv
    vakvirvdprkghidlslrrvtqqqrkaklqefkraqkaenllklaaeklgkdfetawre
    vwvpleeewgevyaafedaakdgidvlkghvpdewlpvlkeiidnyvevptvtidaefei
    tvpkpngveiikealirardrankekdvevkftylgapryriditapdyykaeevlesia
    eeilrvikeaggeatllrkek